-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Glucosylceramidase beta (GBA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 437-536 of human Glucosylceramidase beta (GBA) (P04062) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Glucosylceramidase beta (GBA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 437-536 of human Glucosylceramidase beta (GBA) (P04062) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13623A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Glucosylceramidase beta (GBA) |
| Target Synonyms | GBA; GCB; GLUC; Glucosylceramidase beta (GBA) | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, MCF7, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 437-536 of human Glucosylceramidase beta (GBA) (P04062). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ | Uniprot ID | P04062 |
Uniprot Id
P04062
Target Species
Human
Target Name
GBA1
Target Full Name
Lysosomal acid glucosylceramidase
Target Function
Glucosylceramidase that catalyzes, within the lysosomal compartment, the hydrolysis of glucosylceramide/GlcCer into free ceramide and glucose. Thereby, plays a central role in the degradation of complex lipids and the turnover of cellular membranes. Through the production of ceramides, participates in the PKC-activated salvage pathway of ceramide formation. Also plays a role in cholesterol metabolism. May either catalyze the glucosylation of cholesterol, through a transglucosylation reaction that transfers glucose from glucosylceramide to cholesterol. The short chain saturated C8:0-GlcCer and the mono-unsaturated C18:0-GlcCer being the most effective glucose donors for that transglucosylation reaction. Under specific conditions, may alternatively catalyze the reverse reaction, transferring glucose from cholesteryl-beta-D-glucoside to ceramide. Finally, may also hydrolyze cholesteryl-beta-D-glucoside to produce D-glucose and cholesterol.
Target Involvement
Gaucher disease (GD); Gaucher disease 1 (GD1); Gaucher disease 2 (GD2); Gaucher disease 3 (GD3); Gaucher disease 3C (GD3C); Gaucher disease perinatal lethal (GDPL); Parkinson disease (PARK)
Target Subcellular Location
Lysosome membrane; Peripheral membrane protein; Lumenal side.
Target Protein Families
Glycosyl hydrolase 30 family
Target Research Area
Neuroscience
Target Synonyms
Acid beta glucosidase; Acid beta-glucosidase; Alglucerase; Beta glucocerebrosidase; BETA GLUCOSIDASE, ACID; Beta-glucocerebrosidase; betaGC; D glucosyl N acylsphingosine glucohydrolase; D-glucosyl-N-acylsphingosine glucohydrolase; EC 3.2.1.45; GBA; Gba protein; GBA1; GC; GCase; GCB; GLCM_HUMAN; GLUC; Glucocerebrosidase (alt.); Glucocerebrosidase; GLUCOCEREBROSIDASE PSEUDOGENE; Glucosidase beta; Glucosidase, beta, acid; Glucosidase, beta, acid (includes glucosylceramidase); Glucosylceramidase; Imiglucerase; Lysosomal glucocerebrosidase; OTTHUMP00000033992; OTTHUMP00000033993
Target Background
This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants.
Notification