-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GluR2/GRIA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 330-470 of human GluR2/GRIA2 (NP_001077088.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GluR2/GRIA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 330-470 of human GluR2/GRIA2 (NP_001077088.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14780A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GluR2/GRIA2 |
| Target Synonyms | GLUR2; GLURB; GluA2; HBGR2; NEDLIB; gluR-2; gluR-B; GluR-K2; GluR2/GRIA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 330-470 of human GluR2/GRIA2 (NP_001077088.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGK | Uniprot ID | P42262 |
Uniprot Id
P42262
Target Species
Human
Target Name
GRIA2
Target Full Name
Glutamate receptor 2
Target Function
Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system. It plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate. Through complex formation with NSG1, GRIP1 and STX12 controls the intracellular fate of AMPAR and the endosomal sorting of the GRIA2 subunit toward recycling and membrane targeting.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic density membrane; Multi-pass membrane protein.
Target Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, GRIA2 subfamily
Target Research Area
Neuroscience
Target Synonyms
AMPA 2; AMPA selective glutamate receptor 2 ; AMPA-selective glutamate receptor 2; AMPA2; GluA2; GLUR 2; GLUR B; GluR K2; GluR-2; GluR-B; GluR-K2; GLUR2; GLURB; Glutamate receptor 2; Glutamate receptor ionotropic AMPA 2; Glutamate receptor ionotropic; Gria2; GRIA2_HUMAN; HBGR2
Target Background
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to a family of glutamate receptors that are sensitive to alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA), and function as ligand-activated cation channels. These channels are assembled from 4 related subunits, GRIA1-4. The subunit encoded by this gene (GRIA2) is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to render the channel impermeable to Ca(2+). Human and animal studies suggest that pre-mRNA editing is essential for brain function, and defective GRIA2 RNA editing at the Q/R site may be relevant to amyotrophic lateral sclerosis (ALS) etiology. Alternative splicing, resulting in transcript variants encoding different isoforms, (including the flip and flop isoforms that vary in their signal transduction properties), has been noted for this gene.
Notification