Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLUT3/SLC2A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 207-281 of human GLUT3/SLC2A3 (NP_008862.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GLUT3/SLC2A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 207-281 of human GLUT3/SLC2A3 (NP_008862.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11733A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLUT3/SLC2A3 |
| Target Synonyms | GLUT3; GLUT3/SLC2A3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 207-281 of human GLUT3/SLC2A3 (NP_008862.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQ | Uniprot ID | P11169 |
Uniprot Id
P11169
Target Species
Human
Target Name
SLC2A3
Target Full Name
Solute carrier family 2, facilitated glucose transporter member 3
Target Function
Facilitative glucose transporter that can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Perikaryon. Cell projection.
Target Protein Families
Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily
Target Tissue Specificity
Highly expressed in brain. Expressed in many tissues.
Target Synonyms
brain; FLJ90380; Glucose transporter type 3; Glucose transporter type 3 brain; GLUT 3; GLUT-3; GLUT3; GTR3_HUMAN; Slc2a3; Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 3; Solute carrier family 2, facilitated glucose transporter member 3
Target Background
Enables dehydroascorbic acid transmembrane transporter activity; glucose binding activity; and glucose transmembrane transporter activity. Involved in glucose import across plasma membrane and transport across blood-brain barrier. Is integral component of plasma membrane. Biomarker of Alzheimer's disease; acanthosis nigricans; diabetes mellitus; and type 2 diabetes mellitus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
