Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Glutaminase (GLS) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 610-669 of human Glutaminase (Glutaminase (GLS)) (NP_055720.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Glutaminase (GLS) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 610-669 of human Glutaminase (Glutaminase (GLS)) (NP_055720.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11604A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Glutaminase (GLS) |
| Target Synonyms | GAC; GAM; KGA; GLS1; AAD20; DEE71; GDPAG; CASGID; EIEE71; Glutaminase (GLS) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Mouse brain, Rat kidney, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 610-669 of human Glutaminase (Glutaminase (GLS)) (NP_055720.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL | Uniprot ID | O94925 |
Uniprot Id
O94925
Target Species
Human
Target Name
GLS
Target Full Name
Glutaminase kidney isoform, mitochondrial
Target Function
Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate, the main excitatory neurotransmitter in the brain.; Lacks catalytic activity.
Target Subcellular Location
[Isoform 1]: Mitochondrion. Cytoplasm, cytosol.; [Isoform 3]: Mitochondrion.; [Glutaminase kidney isoform, mitochondrial 68 kDa chain]: Mitochondrion matrix.; [Glutaminase kidney isoform, mitochondrial 65 kDa chain]: Mitochondrion matrix.
Target Protein Families
Glutaminase family
Target Tissue Specificity
Isoform 1 and isoform 3 are detected in brain cortex. Isoform 3 is highly expressed in astrocytoma, ganglioglioma and ependymoma. Isoform 1 is highly expressed in brain and kidney, but not detected in liver. Isoform 3 is highly expressed in heart and panc
Target Research Area
Signal Transduction, Metabolism
Target Synonyms
AAD20; DKFZp686O15119; FLJ10358; GAC; GAM; GLS; GLS1; GLSK_HUMAN; Glutaminase C; Glutaminase kidney isoform; Glutaminase phosphate activated; K-glutaminase; KGA; KIAA0838; L glutamine amidohydrolase; L-glutamine amidohydrolase; mitochondrial
Target Background
This gene encodes the K-type mitochondrial glutaminase. The encoded protein is an phosphate-activated amidohydrolase that catalyzes the hydrolysis of glutamine to glutamate and ammonia. This protein is primarily expressed in the brain and kidney plays an essential role in generating energy for metabolism, synthesizing the brain neurotransmitter glutamate and maintaining acid-base balance in the kidney. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
