Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Glutaredoxin 1 (GLRX) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 11-106 of human Glutaredoxin 1 (GLRX) (NP_002055.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Glutaredoxin 1 (GLRX) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 11-106 of human Glutaredoxin 1 (GLRX) (NP_002055.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15175A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Glutaredoxin 1 (GLRX) |
| Target Synonyms | GRX; GRX1; Glutaredoxin 1 (GLRX) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse liver, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 11-106 of human Glutaredoxin 1 (GLRX) (NP_002055.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ | Uniprot ID | P35754 |
Uniprot Id
P35754
Target Species
Human
Target Name
GLRX
Target Full Name
Glutaredoxin-1
Target Function
Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Glutaredoxin family
Target Research Area
Transport
Target Synonyms
GLRX; Glrx1; GLRX1_HUMAN; Glutaredoxin; Glutaredoxin-1; Glutaredoxin1; Grx 1; Grx; Grx1; MGC117407; Thioltransferase 1; Thioltransferase; Thioltransferase-1; Thioltransferase1; TTase ; TTase 1; TTase-1; TTase1
Target Background
This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
