Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Glycogen synthase 1 (GYS1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 638-737 of human Glycogen synthase (P13807) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Glycogen synthase 1 (GYS1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 638-737 of human Glycogen synthase (P13807) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16124A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Glycogen synthase 1 (GYS1) |
| Target Synonyms | GSY; GYS; Glycogen synthase 1 (GYS1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, 293T, Mouse brain, RD | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 638-737 of human Glycogen synthase (P13807). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN | Uniprot ID | P13807 |
Uniprot Id
P13807
Target Species
Human
Target Name
GYS1
Target Full Name
Glycogen [starch] synthase, muscle
Target Function
Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
Target Involvement
Muscle glycogen storage disease 0 (GSD0b)
Target Protein Families
Glycosyltransferase 3 family
Target Synonyms
Glycogen [starch] synthase; Glycogen synthase 1 (muscle); Glycogen synthase 1; GSY; GYS; Gys1; GYS1_HUMAN; muscle
Target Background
The protein encoded by this gene catalyzes the addition of glucose monomers to the growing glycogen molecule through the formation of alpha-1, 4-glycoside linkages. Mutations in this gene are associated with muscle glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
