Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GMFB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GMFB (NP_004115.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GMFB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GMFB (NP_004115.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01138A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GMFB |
| Target Synonyms | GMF; GMFB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, LO2, MCF7, Mouse brain, Mouse liver, Rat kidney, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GMFB (NP_004115.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGF | Uniprot ID | P60983 |
Uniprot Id
P60983
Target Species
Human
Target Name
GMFB
Target Full Name
Glia maturation factor beta
Target Function
This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.
Target Protein Families
Actin-binding proteins ADF family, GMF subfamily
Target Synonyms
Glia maturation factor beta; GMF; GMF-beta; GMFB; GMFB_HUMAN
Target Background
Predicted to enable Arp2/3 complex binding activity. Predicted to be involved in actin filament debranching and negative regulation of Arp2/3 complex-mediated actin nucleation. Predicted to act upstream of or within learning and locomotory behavior.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
