Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GMIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human GMIP (NP_057657.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GMIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human GMIP (NP_057657.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07031A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GMIP |
| Target Synonyms | ARHGAP46; GMIP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Mouse brain, Mouse spleen, Mouse thymus, Rat thymus, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human GMIP (NP_057657.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDAAEPGLPPGPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPLLSEDPEPDKTPTATVTNEASCWSGPSPEGPVPLTGEELDLRLIRTK | Uniprot ID | Q9P107 |
Uniprot Id
Q9P107
Target Species
Human
Target Name
GMIP
Target Full Name
GEM-interacting protein
Target Function
Stimulates, in vitro and in vivo, the GTPase activity of RhoA.
Target Synonyms
ARHGAP46; GEM interacting protein; GEM-interacting protein; GMIP; GMIP_HUMAN
Target Background
This gene encodes a member of the ARHGAP family of Rho/Rac/Cdc42-like GTPase activating proteins. The encoded protein interacts with the Ras-related protein Gem through its N-terminal domain. Separately, it interacts with RhoA through a RhoGAP domain, and stimulates RhoA-dependent GTPase activity. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
