-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNA11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human GNA11 (NP_002058.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GNA11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human GNA11 (NP_002058.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02968A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNA11 |
| Target Synonyms | FBH; FBH2; FHH2; HG1K; HHC2; GNA-11; HYPOC2; GNA11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, PC-3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GNA11 (NP_002058.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ | Uniprot ID | P29992 |
Uniprot Id
P29992
Target Species
Human
Target Name
GNA11
Target Full Name
Guanine nucleotide-binding protein subunit alpha-11
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Acts as an activator of phospholipase C. Transduces FFAR4 signaling in response to long-chain fatty acids (LCFAs).
Target Involvement
Hypocalciuric hypercalcemia, familial 2 (HHC2); Hypocalcemia, autosomal dominant 2 (HYPOC2)
Target Subcellular Location
Cell membrane; Lipid-anchor. Cytoplasm. Note=In testicular cells, expressed exclusively in the cytoplasm.
Target Protein Families
G-alpha family, G(q) subfamily
Target Tissue Specificity
Expressed in testis.
Target Synonyms
G alpha-11; G-protein subunit alpha-11; GA11; GNA11; GNA11_HUMAN; guanine nucleotide binding protein (G protein); alpha 11 (Gq class); Guanine nucleotide-binding protein G(y) subunit alpha; Guanine nucleotide-binding protein subunit alpha-11; guanine nucleotide-binding protein; alpha 11; guanine nucleotide-binding protein; Gq class; GNA11
Target Background
The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations.
Notification