-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNA12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 285-381 of human GNA12 (NP_031379.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GNA12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 285-381 of human GNA12 (NP_031379.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06071A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNA12 |
| Target Synonyms | RMP; gep; NNX3; HG1M1; GNA12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse pancreas, Rat pancreas | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 285-381 of human GNA12 (NP_031379.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFHAVKDTILQENLKDIMLQ | Uniprot ID | Q03113 |
Uniprot Id
Q03113
Target Species
Human
Target Name
GNA12
Target Full Name
Guanine nucleotide-binding protein subunit alpha-12
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Activates effector molecule RhoA by binding and activating RhoGEFs (ARHGEF12/LARG). GNA12-dependent Rho signaling subsequently regulates transcription factor AP-1 (activating protein-1). GNA12-dependent Rho signaling also regulates protein phosphatese 2A activation causing dephosphorylation of its target proteins. Promotes tumor cell invasion and metastasis by activating RhoA/ROCK signaling pathway and up-regulating proinflammatory cytokine production. Inhibits CDH1-mediated cell adhesion in process independent from Rho activation. Together with NAPA promotes CDH5 localization to plasma membrane. May play a role in the control of cell migration through the TOR signaling cascade.
Target Subcellular Location
Cell membrane; Lipid-anchor. Lateral cell membrane; Lipid-anchor. Cytoplasm.
Target Protein Families
G-alpha family, G(12) subfamily
Target Synonyms
RMP; gep; NNX3; HG1M1; GNA12
Target Background
Predicted to enable D5 dopamine receptor binding activity; G-protein beta/gamma-subunit complex binding activity; and GTPase activity. Involved in regulation of TOR signaling and regulation of proteasomal ubiquitin-dependent protein catabolic process. Located in focal adhesion.
Notification