-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNAI1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GNAI1 (NP_002060.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNAI1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GNAI1 (NP_002060.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01092A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNAI1 |
| Target Synonyms | Gi; HG1B; NEDHISB; GNAI1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GNAI1 (NP_002060.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLND | Uniprot ID | P63096 |
Uniprot Id
P63096
Target Species
Human
Target Name
GNAI1
Target Full Name
Guanine nucleotide-binding protein G(i) subunit alpha-1
Target Function
Guanine nucleotide-binding proteins (G proteins) function as transducers downstream of G protein-coupled receptors (GPCRs) in numerous signaling cascades. The alpha chain contains the guanine nucleotide binding site and alternates between an active, GTP-bound state and an inactive, GDP-bound state. Signaling by an activated GPCR promotes GDP release and GTP binding. The alpha subunit has a low GTPase activity that converts bound GTP to GDP, thereby terminating the signal. Both GDP release and GTP hydrolysis are modulated by numerous regulatory proteins. Signaling is mediated via effector proteins, such as adenylate cyclase. Inhibits adenylate cyclase activity, leading to decreased intracellular cAMP levels. The inactive GDP-bound form prevents the association of RGS14 with centrosomes and is required for the translocation of RGS14 from the cytoplasm to the plasma membrane. Required for normal cytokinesis during mitosis. Required for cortical dynein-dynactin complex recruitment during metaphase.
Target Subcellular Location
Nucleus. Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cell cortex. Membrane; Lipid-anchor.
Target Protein Families
G-alpha family, G(i/o/t/z) subfamily
Target Research Area
Signal Transduction
Target Synonyms
Adenylate cyclase inhibiting G alpha protein; Adenylate cyclase inhibitory protein; Adenylate cyclase-inhibiting G alpha protein; G protein alpha inhibiting 1; G protein alpha inhibiting activity polypeptide 1; Gi; Gi inhibitory G protein; Gi1 protein alpha subunit; GNAI 1; GNAI1; GNAI1_HUMAN; Guanine nucleotide binding protein (G protein) alpha inhibiting activity polypeptide 1; Guanine nucleotide binding protein alpha inhibiting activity polypeptide 1; Guanine nucleotide binding protein G(i) alpha 1 subunit; Guanine nucleotide-binding protein G(i) subunit alpha-1; OTTHUMP00000161319; OTTHUMP00000208047
Target Background
Guanine nucleotide binding proteins are heterotrimeric signal-transducing molecules consisting of alpha, beta, and gamma subunits. The alpha subunit binds guanine nucleotide, can hydrolyze GTP, and can interact with other proteins. The protein encoded by this gene represents the alpha subunit of an inhibitory complex. The encoded protein is part of a complex that responds to beta-adrenergic signals by inhibiting adenylate cyclase. Two transcript variants encoding different isoforms have been found for this gene.
Notification