-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNAI2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-355 of human GNAI2 (P04899) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GNAI2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-355 of human GNAI2 (P04899) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13402A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNAI2 |
| Target Synonyms | GIP; HG1C; GNAI2B; H_LUCA15.1; H_LUCA16.1; GNAI2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Mouse thymus, Rat lung, Rat thymus, U-937 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-355 of human GNAI2 (P04899). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF | Uniprot ID | P04899 |
Uniprot Id
P04899
Target Species
Human
Target Name
GNAI2
Target Full Name
Guanine nucleotide-binding protein G(i) subunit alpha-2
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli. May play a role in cell division.; Regulates the cell surface density of dopamine receptors DRD2 by sequestrating them as an intracellular pool.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cell membrane. Membrane; Lipid-anchor. Note=Localizes in the centrosomes of interphase and mitotic cells. Detected at the cleavage furrow and/or the midbody.
Target Protein Families
G-alpha family, G(i/o/t/z) subfamily
Target Synonyms
Adenylate cyclase inhibiting G alpha protein ; Adenylate cyclase-inhibiting G alpha protein; GIP; GNAI 2; Gnai2; GNAI2_HUMAN; GNAI2B; GTP binding regulatory protein Gi alpha 2 chain; Guanine nucleotide binding protein G protein alpha inhibiting activity polypeptide 2 ; Guanine nucleotide-binding protein G(i) subunit alpha-2; H LUCA15.1; H LUCA16.1; WUGSC:H LUCA15.1; WUGSC:H LUCA16.1
Target Background
The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been found for this gene.
Notification