Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNAO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human GNAO1 (NP_066268.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GNAO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human GNAO1 (NP_066268.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09875A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNAO1 |
| Target Synonyms | GNAO; HG1G; DEE17; NEDIM; EIEE17; HLA-DQB1; G-ALPHA-o; GNAO1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse spinal cord | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human GNAO1 (NP_066268.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV | Uniprot ID | P09471 |
Uniprot Id
P09471
Target Species
Human
Target Name
GNAO1
Target Full Name
Guanine nucleotide-binding protein G(o) subunit alpha
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear. Stimulated by RGS14.
Target Involvement
Epileptic encephalopathy, early infantile, 17 (EIEE17); Neurodevelopmental disorder with involuntary movements (NEDIM)
Target Subcellular Location
Cell membrane. Membrane; Lipid-anchor.
Target Protein Families
G-alpha family, G(i/o/t/z) subfamily
Target Synonyms
DKFZp686O0962; G alpha o; G protein alpha 0; Galphao; GNAO 1; GNAO; GNAO_HUMAN; GNAO1; Go alpha; Guanine nucleotide binding protein (G protein) alpha activating activity polypeptide O; Guanine nucleotide binding protein alpha activating polypeptide ; Guanine nucleotide binding protein G(o) subunit alpha; Guanine nucleotide-binding protein G(o) subunit alpha
Target Background
The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
