Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNAZ was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human GNAZ (NP_002064.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNAZ was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human GNAZ (NP_002064.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05482A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNAZ |
| Target Synonyms | HG1H; gz-alpha; GNAZ | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GNAZ (NP_002064.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK | Uniprot ID | P19086 |
Uniprot Id
P19086
Target Species
Human
Target Name
GNAZ
Target Full Name
Guanine nucleotide-binding protein G(z) subunit alpha
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Target Subcellular Location
Membrane; Lipid-anchor.
Target Protein Families
G-alpha family, G(i/o/t/z) subfamily
Target Research Area
Signal Transduction
Target Synonyms
G(x) alpha chain; GNAZ; GNAZ_HUMAN; Guanine nucleotide-binding protein G(z) subunit alpha; Gz-alpha
Target Background
The protein encoded by this gene is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This encoded protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
