-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human GNB2 (P62879) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GNB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human GNB2 (P62879) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16153A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNB2 |
| Target Synonyms | SSS4; HG2C1; NEDHYDF; GNB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Rat brain, Jurkat, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human GNB2 (P62879). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKV | Uniprot ID | P62879 |
Uniprot Id
P62879
Target Species
Human
Target Name
GNB2
Target Full Name
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Target Subcellular Location
Cytoplasm, perinuclear region.
Target Protein Families
WD repeat G protein beta family
Target Research Area
Metabolism
Target Synonyms
G protein beta 2 subunit; G protein subunit beta 2; G protein subunit beta-2; GBB2_HUMAN; Gnb2; Gnb2l1; Guanine nucleotide binding protein beta 2 subunit; Guanine nucleotide binding protein G I G S G T beta 2 subunit 2; Guanine nucleotide binding protein G protein beta polypeptide 2; Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2; OTTHUMP00000174601; OTTHUMP00000174602; RACK1; Receptor for activated C kinase; Receptor of activated protein kinase C 1; Signal transducing guanine nucleotide binding regulatory protein beta; Transducin beta chain 2
Target Background
Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR.
Notification