-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNB5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human GNB5 (NP_006569.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNB5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human GNB5 (NP_006569.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11227A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNB5 |
| Target Synonyms | GB5; HG2E; IDDCA; LADCI; gbeta5; GNB5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, HL-60, Jurkat, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human GNB5 (NP_006569.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLC | Uniprot ID | O14775 |
Uniprot Id
O14775
Target Species
Human
Target Name
GNB5
Target Full Name
Guanine nucleotide-binding protein subunit beta-5
Target Function
Enhances GTPase-activating protein (GAP) activity of regulator of G protein signaling (RGS) proteins, hence involved in the termination of the signaling initiated by the G protein coupled receptors (GPCRs) by accelerating the GTP hydrolysis on the G-alpha subunits, thereby promoting their inactivation (Probable). Increases RGS9 GTPase-activating protein (GAP) activity, hence contributes to the deactivation of G protein signaling initiated by D(2) dopamine receptors. May play an important role in neuronal signaling, including in the parasympathetic, but not sympathetic, control of heart rate.
Target Involvement
Intellectual developmental disorder with cardiac arrhythmia (IDDCA); Language delay and attention deficit-hyperactivity disorder/cognitive impairment with or without cardiac arrhythmia (LADCI)
Target Subcellular Location
Membrane.
Target Protein Families
WD repeat G protein beta family
Target Tissue Specificity
Widely expressed.
Target Research Area
Signal Transduction
Target Synonyms
FLJ37457; FLJ43714; G protein beta 5 subunit; G protein beta subunit 5L; GB 5; GB5; GBB5_HUMAN; Gbeta5; GNB 5; GNB5; Guanine nucleotide binding protein (G protein) beta 5; Guanine nucleotide binding protein beta 5; Guanine nucleotide binding protein beta 5 subunit; Guanine nucleotide binding protein beta subunit 5L; Guanine nucleotide binding protein subunit beta 5; Guanine nucleotide-binding protein subunit beta-5; Transducin beta chain 5
Target Background
Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist.
Notification