Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNG10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human GNG10 (NP_001017998.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNG10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human GNG10 (NP_001017998.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01376A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNG10 |
| Target Synonyms | GNG10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, Mouse spleen, Rat spleen, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human GNG10 (NP_001017998.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL | Uniprot ID | P50151 |
Uniprot Id
P50151
Target Species
Human
Target Name
GNG10
Target Full Name
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
G protein gamma family
Target Tissue Specificity
Abundantly and ubiquitously expressed.
Target Synonyms
GBG10_HUMAN; GNG10; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
Target Background
Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to be located in plasma membrane. Predicted to be part of heterotrimeric G-protein complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
