-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNG7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human GNG7 (NP_443079.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNG7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human GNG7 (NP_443079.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12064A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNG7 |
| Target Synonyms | HG3B; GNG7 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human GNG7 (NP_443079.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL | Uniprot ID | O60262 |
Uniprot Id
O60262
Target Species
Human
Target Name
GNG7
Target Full Name
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Plays a role in the regulation of adenylyl cyclase signaling in certain regions of the brain. Plays a role in the formation or stabilzation of a G protein heterotrimer (G(olf) subunit alpha-beta-gamma-7) that is required for adenylyl cyclase activity in the striatum.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
G protein gamma family
Target Tissue Specificity
Expressed in a variety of tissues. Down-regulated in pancreatic and esophageal cancer.
Target Synonyms
GNG7; GNGT7; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Target Background
Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway and regulation of adenylate cyclase activity. Predicted to act upstream of or within behavioral fear response; locomotory behavior; and receptor guanylyl cyclase signaling pathway. Located in extracellular exosome.
Notification