Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNPDA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GNPDA2 (NP_612208.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNPDA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GNPDA2 (NP_612208.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01018A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNPDA2 |
| Target Synonyms | GNP2; SB52; GNPDA2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, HT-1080, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GNPDA2 (NP_612208.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGV | Uniprot ID | Q8TDQ7 |
Uniprot Id
Q8TDQ7
Target Species
Human
Target Name
GNPDA2
Target Full Name
Glucosamine-6-phosphate deaminase 2
Target Subcellular Location
Cytoplasm.
Target Protein Families
Glucosamine/galactosamine-6-phosphate isomerase family
Target Synonyms
GlcN6P deaminase 2; Glucosamine 6 phosphate deaminase 2; Glucosamine 6 phosphate isomerase 2; Glucosamine 6 phosphate isomerase SB52; Glucosamine-6-phosphate deaminase 2; Glucosamine-6-phosphate isomerase 2; Glucosamine-6-phosphate isomerase SB52; GNP2; GNPDA 2; Gnpda2; GNPI2_HUMAN; SB52
Target Background
The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
