Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNPNAT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human GNPNAT1 (NP_932332.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GNPNAT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human GNPNAT1 (NP_932332.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07076A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNPNAT1 |
| Target Synonyms | GNA1; GNPNAT; Gpnat1; RHZDAN; GNPNAT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, BxPC-3, HT-29, LO2, Mouse lung, Rat kidney, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human GNPNAT1 (NP_932332.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVED | Uniprot ID | Q96EK6 |
Uniprot Id
Q96EK6
Target Species
Human
Target Name
GNPNAT1
Target Full Name
Glucosamine 6-phosphate N-acetyltransferase
Target Subcellular Location
Golgi apparatus membrane; Peripheral membrane protein. Endosome membrane; Peripheral membrane protein.
Target Protein Families
Acetyltransferase family, GNA1 subfamily
Target Synonyms
AU017428; AU040593; EMeg32; FLJ10607; Glucosamine 6 phosphate acetyltransferase; Glucosamine 6 phosphate N acetyltransferase; Glucosamine 6-phosphate N-acetyltransferase; Glucosamine phosphate N acetyltransferase 1; GNA1; GNA1_HUMAN; GNPNAT; GNPNAT1; Gpnat1; Gsnpat; Phosphoglucosamine acetylase; Phosphoglucosamine transacetylase; RGD1563144
Target Background
Enables identical protein binding activity. Predicted to be involved in UDP-N-acetylglucosamine biosynthetic process. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Predicted to be located in late endosome. Predicted to be active in Golgi apparatus; endoplasmic reticulum; and endoplasmic reticulum-Golgi intermediate compartment.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
