Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GnRH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-92 of human GNRH1(NP_001076580.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GnRH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-92 of human GNRH1(NP_001076580.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08541A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNRH1 |
| Target Synonyms | GRH; GNRH; LHRH; LNRH | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with GnRH1 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-92 of human GNRH1(NP_001076580.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI | Uniprot ID | P01148 |
Uniprot Id
P01148
Target Species
Human
Target Name
GNRH1
Target Full Name
Progonadoliberin-1
Target Function
Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Target Involvement
Hypogonadotropic hypogonadism 12 with or without anosmia (HH12)
Target Subcellular Location
Secreted.
Target Protein Families
GnRH family
Target Synonyms
GNRH1; GNRH; GRH; LHRHProgonadoliberin-1; Progonadoliberin I) [Cleaved into: Gonadoliberin-1; Gonadoliberin I; Gonadorelin; Gonadotropin-releasing hormone I; GnRH-I; Luliberin I; Luteinizing hormone-releasing hormone I; LH-RH I); GnRH-associated peptide 1; GnRH-associated peptide I)]
Target Background
This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
