Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GOLGA7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human GOLGA7 (NP_001167595.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GOLGA7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human GOLGA7 (NP_001167595.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05389A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GOLGA7 |
| Target Synonyms | GCP16; GOLGA7A; HSPC041; GOLGA3AP1; GOLGA7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, MCF7, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human GOLGA7 (NP_001167595.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVFRLKLPFMKTEA | Uniprot ID | Q7Z5G4 |
Uniprot Id
Q7Z5G4
Target Species
Human
Target Name
GOLGA7
Target Full Name
Golgin subfamily A member 7
Target Function
May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
Target Subcellular Location
Golgi apparatus membrane; Lipid-anchor.
Target Protein Families
ERF4 family
Target Tissue Specificity
Expressed in all tissues except colon and thymus.
Target Synonyms
GOLGA7; GCP16; HDCKB03P; HSPC041Golgin subfamily A member 7; Golgi complex-associated protein of 16 kDa
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
