Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GOLPH4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GOLPH4 (O00461) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GOLPH4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GOLPH4 (O00461) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14266A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GOLPH4 |
| Target Synonyms | P138; GIMPC; GOLPH4; GPP130 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Hep G2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GOLPH4 (O00461). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETL | Uniprot ID | O00461 |
Uniprot Id
O00461
Target Species
Human
Target Name
GOLIM4
Target Full Name
Golgi integral membrane protein 4
Target Function
Plays a role in endosome to Golgi protein trafficking; mediates protein transport along the late endosome-bypass pathway from the early endosome to the Golgi.
Target Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Endosome membrane; Single-pass type II membrane protein. Membrane; Lipid-anchor. Note=Localizes to cis and medial Golgi cisternae. Probably cycles between early Golgi and distal compartments like endosome.
Target Protein Families
GOLIM4 family
Target Synonyms
GOLIM4; GIMPC; GOLPH4; GPP130; Golgi integral membrane protein 4; Golgi integral membrane protein, cis; GIMPc; Golgi phosphoprotein 4; Golgi-localized phosphoprotein of 130 kDa; Golgi phosphoprotein of 130 kDa
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
