Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 357-556 of human GPC4 (NP_001439.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 357-556 of human GPC4 (NP_001439.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03247A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPC4 |
| Target Synonyms | KPTS; K-glypican; GPC4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-431, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 357-556 of human GPC4 (NP_001439.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SESAFSARFRPHHPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNGNEDDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMALRVMTSKMKNAYNGNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQREWR | Uniprot ID | O75487 |
Uniprot Id
O75487
Target Species
Human
Target Name
GPC4
Target Full Name
Glypican-4
Target Function
Cell surface proteoglycan that bears heparan sulfate. May be involved in the development of kidney tubules and of the central nervous system.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor; Extracellular side.; [Secreted glypican-4]: Secreted, extracellular space.
Target Protein Families
Glypican family
Target Synonyms
dJ900E8.1 glypican 4; Glypican proteoglycan 4; Gpc4; GPC4_HUMAN; K Glypican; K-glypican; Kglypican; OTTHUMP00000024052; Secreted glypican 4; Secreted glypican-4; UNQ474/PRO937
Target Background
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The GPC4 gene is adjacent to the 3' end of GPC3 and may also play a role in Simpson-Golabi-Behmel syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
