Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 255-374 of human GPN1 (NP_009197.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 255-374 of human GPN1 (NP_009197.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02215A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPN1 |
| Target Synonyms | XAB1; MBDIN; NTPBP; RPAP4; ATPBD1A; GPN1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse lung, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 255-374 of human GPN1 (NP_009197.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNF | Uniprot ID | Q9HCN4 |
Uniprot Id
Q9HCN4
Target Species
Human
Target Name
GPN1
Target Full Name
GPN-loop GTPase 1
Target Function
Small GTPase required for proper nuclear import of RNA polymerase II (RNAPII). May act at an RNAP assembly step prior to nuclear import. Forms an interface between the RNA polymerase II enzyme and chaperone/scaffolding proteins, suggesting that it is required to connect RNA polymerase II to regulators of protein complex formation. May be involved in nuclear localization of XPA.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
GPN-loop GTPase family
Target Tissue Specificity
Expressed ubiquitously.
Target Synonyms
ATP(GTP) binding protein; ATPBD1A; FLJ51176; GPN loop GTPase 1; GPN-loop GTPase 1; Gpn1; GPN1_HUMAN; MBD2 interacting protein; MBD2-interacting protein; MBDin; NTPBP; RNA polymerase II associated protein 4; RPAP4; XAB1; XPA binding protein 1; XPA binding protein 1 GTPase; XPA-binding protein 1
Target Background
This gene encodes a guanosine triphosphatase enzyme. The encoded protein may play a role in DNA repair and may function in activation of transcription. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
