Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR139 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-353 of human GPR139 (Q6DWJ6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR139 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-353 of human GPR139 (Q6DWJ6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04724A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR139 |
| Target Synonyms | PGR3; GPRg1; GPR139 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 290-353 of human GPR139 (Q6DWJ6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDKNGKPIKVSP | Uniprot ID | Q6DWJ6 |
Uniprot Id
Q6DWJ6
Target Species
Human
Target Name
GPR139
Target Full Name
Probable G-protein coupled receptor 139
Target Function
Orphan receptor. Seems to act through a G(q/11)-mediated pathway.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed almost exclusively in the brain. Detected at very low levels in the peripheral tissues.
Target Synonyms
GPR139; GPRG1; PGR3; Probable G-protein coupled receptor 139; G(q-coupled orphan receptor GPRg1; G-protein-coupled receptor PGR3
Target Background
This gene encodes a member of the rhodopsin family of G-protein-coupled receptors. The encoded protein is almost exclusively expressed in the central nervous system. L-tryptophan and L-phenylalanine may act as the physiologic ligands of the encoded protein. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
