Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR182 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human GPR182 (NP_009195.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR182 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human GPR182 (NP_009195.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08827A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR182 |
| Target Synonyms | AMR; 7TMR; ADMR; AM-R; G10D; L1-R; gamrh; hrhAMR; GPR182 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GPR182 (NP_009195.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCA | Uniprot ID | O15218 |
Uniprot Id
O15218
Target Species
Human
Target Name
GPR182
Target Full Name
G-protein coupled receptor 182
Target Function
Orphan receptor.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Highly expressed in heart, skeletal muscle, immune system, adrenal gland and liver.
Target Research Area
Cancer
Target Synonyms
GPR182; ADMR; G-protein coupled receptor 182
Target Background
Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
