Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR62 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human GPR62 (NP_543141.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR62 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human GPR62 (NP_543141.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04592A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR62 |
| Target Synonyms | GPCR8; KPG_005; GPR62 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GPR62 (NP_543141.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTPPAPPPAPARCSVLAGGLGPFRPLWALLAFALPALLLLGAYGGIFVVARRAALRPPRPARGSRLHSDSLDSRLSILPPLRPRLPGGKAALAPALAVGQF | Uniprot ID | Q9BZJ7 |
Uniprot Id
Q9BZJ7
Target Species
Human
Target Name
GPR62
Target Full Name
G-protein coupled receptor 62
Target Function
Orphan G-protein coupled receptor. Constitutively activates the G(q/11)/inositol phosphate and the G(s)-alpha/cAMP signaling pathways. Has spontaneous activity for beta-arrestin recruitment. Shows a reciprocal modulation of signaling functions with the melatonin receptor MTNR1B most likely through receptor heteromerization.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in brain; detected in the basal forebrain, frontal cortex, caudate, putamen, thalamus and hippocampus.
Target Synonyms
GPR62; G-protein coupled receptor 62; G-protein coupled receptor GPCR8; hGPCR8; G-protein coupled receptor KPG_005
Target Background
Enables arrestin family protein binding activity. Involved in G protein-coupled receptor signaling pathway; inositol phosphate-mediated signaling; and positive regulation of cAMP-mediated signaling. Located in endosome and plasma membrane. Part of receptor complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
