Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR68 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR68 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07903A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR68 |
| Target Synonyms | OGR1; AI2A6; GPR12A; GPR68 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFPTGRLA | Uniprot ID | Q15743 |
Uniprot Id
Q15743
Target Species
Human
Target Name
GPR68
Target Full Name
Ovarian cancer G-protein coupled receptor 1
Target Function
Proton-sensing receptor involved in pH homeostasis. May represents an osteoblastic pH sensor regulating cell-mediated responses to acidosis in bone. Mediates its action by association with G proteins that stimulates inositol phosphate (IP) production or Ca(2+) mobilization. The receptor is almost silent at pH 7.8 but fully activated at pH 6.8. Also functions as a metastasis suppressor gene in prostate cancer.
Target Involvement
Amelogenesis imperfecta, hypomaturation type, 2A6 (AI2A6)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Found at low level in a wide range of tissues, but significantly expressed in lung, kidney, bone and nervous system.
Target Synonyms
GPR68; OGR1; Ovarian cancer G-protein coupled receptor 1; OGR-1; G-protein coupled receptor 68; GPR12A; Sphingosylphosphorylcholine receptor
Target Background
The protein encoded by this gene is a G protein-coupled receptor for sphingosylphosphorylcholine. The encoded protein is a proton-sensing receptor, inactive at pH 7.8 but active at pH 6.8. Mutations in this gene are a cause of amelogenesis imperfecta.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
