-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPRC5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 268-357 of human GPRC5A (NP_003970.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPRC5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 268-357 of human GPRC5A (NP_003970.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09132A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPRC5A |
| Target Synonyms | RAI3; TIG1; RAIG1; GPCR5A; PEIG-1; GPRC5A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MKN-45 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 268-357 of human GPRC5A (NP_003970.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS | Uniprot ID | Q8NFJ5 |
Uniprot Id
Q8NFJ5
Target Species
Human
Target Name
GPRC5A
Target Full Name
Retinoic acid-induced protein 3
Target Function
Orphan receptor. Could be involved in modulating differentiation and maintaining homeostasis of epithelial cells. This retinoic acid-inducible GPCR provide evidence for a possible interaction between retinoid and G-protein signaling pathways. Functions as a negative modulator of EGFR signaling. May act as a lung tumor suppressor.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 3 family
Target Tissue Specificity
Expressed at high level in fetal and adult lung tissues but repressed in most human lung cancers. Constitutively expressed in fetal kidney and adult placenta, kidney, prostate, testis, ovary, small intestine, colon, stomach, and spinal chord at low to mod
Target Research Area
Neuroscience
Target Synonyms
GPRC5A; GPCR5A; RAI3; RAIG1; Retinoic acid-induced protein 3; G-protein coupled receptor family C group 5 member A; Phorbol ester induced gene 1; PEIG-1; Retinoic acid-induced gene 1 protein; RAIG-1
Target Background
This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation.
Notification