Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPRC5B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 304-403 of human GPRC5B (NP_057319.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPRC5B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 304-403 of human GPRC5B (NP_057319.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13311A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPRC5B |
| Target Synonyms | RAIG2; RAIG-2; GPRC5B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A549, K-562 (Low expression control) | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 304-403 of human GPRC5B (NP_057319.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW | Uniprot ID | Q9NZH0 |
Uniprot Id
Q9NZH0
Target Species
Human
Target Name
GPRC5B
Target Full Name
G-protein coupled receptor family C group 5 member B
Target Function
Unknown. This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Note=Localized in the plasma membrane and perinuclear vesicles.
Target Protein Families
G-protein coupled receptor 3 family
Target Tissue Specificity
Expression is high in kidney, pancreas, and testis, medium in brain, heart, prostate, small intestine, and spleen, low in liver, placenta, skeletal muscle, colon, ovary, and thymus, and not detectable in lung and peripheral leukocyte. According to PubMed:
Target Synonyms
GPRC5B; RAIG2; G-protein coupled receptor family C group 5 member B; A-69G12.1; Retinoic acid-induced gene 2 protein; RAIG-2
Target Background
This gene encodes a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The encoded protein may modulate insulin secretion and increased protein expression is associated with type 2 diabetes. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
