Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human GPX2 (NP_002074.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GPX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human GPX2 (NP_002074.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12049A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPX2 |
| Target Synonyms | GPRP; GPx-2; GI-GPx; GPRP-2; GPx-GI; GSHPx-2; GSHPX-GI; GPX2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, HT-29, Mouse stomach, Rat small intestine | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human GPX2 (NP_002074.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP | Uniprot ID | P18283 |
Uniprot Id
P18283
Target Species
Human
Target Name
GPX2
Target Full Name
Glutathione peroxidase 2
Target Function
Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and linoleic acid hydroperoxide but not phosphatidycholine hydroperoxide, can act as acceptors.
Target Subcellular Location
Cytoplasm. Note=Mainly cytoplasmic.
Target Protein Families
Glutathione peroxidase family
Target Tissue Specificity
Mostly in liver and gastrointestinal tract, not found in heart or kidney.
Target Synonyms
Gastrointestinal glutathione peroxidase; GI GPx; Glutathione peroxidase 2 (gastrointestinal); Glutathione peroxidase 2; Glutathione peroxidase gastrointestinal; Glutathione peroxidase related protein 2; Glutathione peroxidase-gastrointestinal; Glutathione peroxidase-related protein 2; GPRP; GPRP-2; GPx 2; GPx-2; GPx-GI; GPX2; GPX2_HUMAN; GSHPx 2; GSHPx GI; GSHPx-2; GSHPx-GI
Target Background
The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is predominantly expressed in the gastrointestinal tract (also in liver in human), is localized in the cytoplasm, and whose preferred substrate is hydrogen peroxide. Overexpression of this gene is associated with increased differentiation and proliferation in colorectal cancer. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
