Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 128-217 of human GRAP (NP_006604.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GRAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 128-217 of human GRAP (NP_006604.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05095A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRAP |
| Target Synonyms | DFNB114; GRAP | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 128-217 of human GRAP (NP_006604.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LNELVDFYRTTTIAKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDPHWWRGRSCGRVGFFPRSYVQPVHL | Uniprot ID | Q13588 |
Uniprot Id
Q13588
Target Species
Human
Target Name
GRAP
Target Full Name
GRB2-related adapter protein
Target Function
Couples signals from receptor and cytoplasmic tyrosine kinases to the Ras signaling pathway. Plays a role in the inner ear and in hearing.
Target Subcellular Location
Membrane; Peripheral membrane protein. Cell junction, synapse.
Target Protein Families
GRB2/sem-5/DRK family
Target Synonyms
Grap; GRAP_HUMAN; GRB2 related adaptor protein; GRB2-related adapter protein; Growth factor receptor bound protein 2 related adaptor protein; MGC64880; OTTHUMP00000065766
Target Background
This gene encodes a member of the GRB2/Sem5/Drk family and functions as a cytoplasmic signaling protein which contains an SH2 domain flanked by two SH3 domains. The SH2 domain interacts with ligand-activated receptors for stem cell factor and erythropoietin, and facilitates the formation of a stable complex with the BCR-ABL oncoprotein. This protein also associates with the Ras guanine nucleotide exchange factor SOS1 (son of sevenless homolog 1) through its N-terminal SH3 domain. In general, it couples signals from receptor and cytoplasmic tyrosine kinases to the Ras signaling pathway.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
