-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRASP65 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 341-440 of human GRASP65 (Q9BQQ3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GRASP65 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 341-440 of human GRASP65 (Q9BQQ3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15961A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRASP65 |
| Target Synonyms | P65; GOLPH5; GRASP65 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Hep G2, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 341-440 of human GRASP65 (Q9BQQ3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGPEDICSSSSSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE | Uniprot ID | Q9BQQ3 |
Uniprot Id
Q9BQQ3
Target Species
Human
Target Name
GORASP1
Target Full Name
Golgi reassembly-stacking protein 1
Target Function
Plays an important role in assembly and membrane stacking of the Golgi cisternae, and in the reassembly of Golgi stacks after breakdown during mitosis. Key structural protein required for the maintenance of the Golgi apparatus integrity: its caspase-mediated cleavage is required for fragmentation of the Golgi during apoptosis. Also mediates, via its interaction with GOLGA2/GM130, the docking of transport vesicles with the Golgi membranes. Mediates ER stress-induced unconventional (ER/Golgi-independent) trafficking of core-glycosylated CFTR to cell membrane.
Target Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Peripheral membrane protein; Cytoplasmic side. Endoplasmic reticulum-Golgi intermediate compartment membrane.
Target Protein Families
GORASP family
Target Synonyms
FLJ23443; Golgi peripheral membrane protein p65; Golgi phosphoprotein 5; Golgi reassembly and stacking protein 1; Golgi reassembly and stacking protein 65 kDa; Golgi reassembly and stacking protein, 65-kD; Golgi reassembly stacking protein 1 65kDa; Golgi reassembly stacking protein 1; Golgi reassembly stacking protein of 65 kDa; Golgi reassembly-stacking protein 1; Golgi reassembly-stacking protein of 65 kDa; GOLPH 5; GOLPH5; Gorasp 1; GORASP1; GORS1_HUMAN; GRASP 65; GRASP65; MGC118894; MGC118897; P65
Target Background
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Alternative splicing results in multiple transcript variants of this gene.
Notification