-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRID2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1007 of human GRID2 (NP_001501.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GRID2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1007 of human GRID2 (NP_001501.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08002A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRID2 |
| Target Synonyms | GluD2; SCAR18; GRID2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brian | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 900-1007 of human GRID2 (NP_001501.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IDLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI | Uniprot ID | O43424 |
Uniprot Id
O43424
Target Species
Human
Target Name
GRID2
Target Full Name
Glutamate receptor ionotropic, delta-2
Target Function
Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. Promotes synaptogenesis and mediates the D-Serine-dependent long term depression signals and AMPA receptor endocytosis of cerebellar parallel fiber-Purkinje cell (PF-PC) synapses through the beta-NRX1-CBLN1-GRID2 triad complex.
Target Involvement
Spinocerebellar ataxia, autosomal recessive, 18 (SCAR18)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Target Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, GRID2 subfamily
Target Synonyms
delta-2; GluD2; GLUR D2; GluR delta 2; GluR delta-2 subunit; GLURD 2; GLURD2; Glutamate receptor delta 2 subunit ; Glutamate receptor ionotropic; Glutamate receptor ionotropic delta 2; GRID 2; Grid2; GRID2_HUMAN; MGC117022; MGC117023; MGC117024
Target Background
The protein encoded by this gene is a member of the family of ionotropic glutamate receptors which are the predominant excitatory neurotransmitter receptors in the mammalian brain. The encoded protein is a multi-pass membrane protein that is expressed selectively in cerebellar Purkinje cells. A point mutation in the mouse ortholog, associated with the phenotype named 'lurcher', in the heterozygous state leads to ataxia resulting from selective, cell-autonomous apoptosis of cerebellar Purkinje cells during postnatal development. Mice homozygous for this mutation die shortly after birth from massive loss of mid- and hindbrain neurons during late embryogenesis. This protein also plays a role in synapse organization between parallel fibers and Purkinje cells. Alternate splicing results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause cerebellar ataxia in humans.
Notification