-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRIK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-220 of human GRIK4 (NP_055434.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GRIK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-220 of human GRIK4 (NP_055434.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06028A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRIK4 |
| Target Synonyms | KA1; EAA1; GRIK; GluK4; GluK4-2; GRIK4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain, Rat kidney, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-220 of human GRIK4 (NP_055434.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHAN | Uniprot ID | Q16099 |
Uniprot Id
Q16099
Target Species
Human
Target Name
GRIK4
Target Full Name
Glutamate receptor ionotropic, kainate 4
Target Function
Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Target Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, GRIK4 subfamily
Target Synonyms
EAA 1; EAA1; Excitatory amino acid receptor 1; GluK4; Glutamate receptor; Glutamate receptor ionotropic kainate 4; Glutamate receptor ionotropic kainate 4 precursor; Glutamate receptor KA 1; Glutamate receptor KA 1precursor; Glutamate receptor KA-1; Glutamate receptor KA1; Glutamate receptor; ionotropic kainate 4; GRIK 4; GRIK; Grik4; GRIK4_HUMAN; ionotropic kainate 4; KA 1; KA1; OTTHUMP00000045951; OTTHUMP00000231881
Target Background
This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification