Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRIK5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-420 of human GRIK5 (NP_002079.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GRIK5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-420 of human GRIK5 (NP_002079.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04911A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRIK5 |
| Target Synonyms | KA2; EAA2; GRIK2; GluK5; GRIK5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-420 of human GRIK5 (NP_002079.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRMVEYDGLTGRVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT | Uniprot ID | Q16478 |
Uniprot Id
Q16478
Target Species
Human
Target Name
GRIK5
Target Full Name
Glutamate receptor ionotropic, kainate 5
Target Function
Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds kainate > quisqualate > domoate > L-glutamate >> AMPA >> NMDA = 1S,3R-ACPD.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Target Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, GRIK5 subfamily
Target Synonyms
EAA 2; EAA2; Excitatory amino acid receptor 2; GluK5; GluRgamma2; Glutamate receptor; Glutamate receptor KA 2; Glutamate receptor KA-2; Glutamate receptor KA2; Glutamate receptor; ionotropic kainate 5 [Precursor]; Glutamate receptor; ionotropic; kainate 5 (gamma 2); Glutamate receptor; ionotropic; kainate 5; GRIK 2; GRIK 5; GRIK2; Grik5; GRIK5_HUMAN; iGlu5; ionotropic kainate 5; KA2; MGC118086
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
