-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 590-689 of human GRK2 (P25098) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GRK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 590-689 of human GRK2 (P25098) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-17183A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Grk2 |
| Target Synonyms | BARK1; ADRBK1; BETA-ARK1; K2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain, Mouse spleen | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 590-689 of human GRK2 (P25098). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL | Uniprot ID | P25098 |
Uniprot Id
P25098
Target Species
Human
Target Name
GRK2
Target Full Name
Beta-adrenergic receptor kinase 1
Target Function
Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner. Positively regulates ciliary smoothened (SMO)-dependent Hedgehog (Hh) signaling pathway by facilitating the trafficking of SMO into the cilium and the stimulation of SMO activity. Inhibits relaxation of airway smooth muscle in response to blue light.
Target Subcellular Location
Cytoplasm. Cell membrane.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, GPRK subfamily
Target Tissue Specificity
Expressed in peripheral blood leukocytes.
Target Research Area
Neuroscience
Target Synonyms
ADRBK1; Adrenergic beta receptor kinase 1; ARBK1_HUMAN; BARK; BARK1; Beta adrenergic receptor kinase 1; Beta ARK 1; Beta ARK1; Beta-adrenergic receptor kinase 1; Beta-ARK-1; FLJ16718; G protein coupled receptor kinase 2; G-protein coupled receptor kinase 2; GRK2
Target Background
This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal, mitochondrial, and transcription factor proteins. Data from rodent models supports a role for this gene in embryonic development, heart function and metabolism. Elevated expression of this gene has been observed in human patients with heart failure and Alzheimer's disease.
Notification