-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRM5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human GRM5 (P41594) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GRM5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human GRM5 (P41594) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15919A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRM5 |
| Target Synonyms | mGlu5; GPRC1E; MGLUR5; PPP1R86; GRM5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human GRM5 (P41594). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAARESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL | Uniprot ID | P41594 |
Uniprot Id
P41594
Target Species
Human
Target Name
GRM5
Target Full Name
Metabotropic glutamate receptor 5
Target Function
G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling activates a phosphatidylinositol-calcium second messenger system and generates a calcium-activated chloride current. Plays an important role in the regulation of synaptic plasticity and the modulation of the neural network activity.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 3 family
Target Research Area
Cancer
Target Synonyms
Glutamate receptor metabotropic 5; GPRC1E; Grm5; GRM5_HUMAN; Metabotropic glutamate receptor 5; Metabotropic glutamate receptor 5 variant F; Metabotropic glutamate receptor 5 variant G; Metabotropic glutamate receptor 5 variant H; mGlu5; mGluR5; PPP1R86; Protein phosphatase 1 regulatory subunit 86
Target Background
This gene encodes a member of the G-protein coupled receptor 3 protein family. The encoded protein is a metabatropic glutamate receptor, whose signaling activates a phosphatidylinositol-calcium second messenger system. This protein may be involved in the regulation of neural network activity and synaptic plasticity. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. A pseudogene of this gene has been defined on chromosome 11. Alternative splicing results in multiple transcript variants.
Notification