Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRO alpha was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-107 of human GRO alpha (NP_001502.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GRO alpha was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-107 of human GRO alpha (NP_001502.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11823A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRO alpha |
| Target Synonyms | FSP; GRO1; GROa; MGSA; NAP-3; SCYB1; MGSA-a; GRO alpha | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NCI-H460 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-107 of human GRO alpha (NP_001502.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN | Uniprot ID | P09341 |
Uniprot Id
P09341
Target Species
Human
Target Name
CXCL1
Target Full Name
Growth-regulated alpha protein
Target Function
Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine alpha (chemokine CxC) family
Target Research Area
Immunology
Target Synonyms
C-X-C motif chemokine 1; Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity; alpha); chemokine (C-X-C motif) ligand 1; CINC-1; CXCL1; Cytokine-induced neutrophil chemoattractant 1; Fibroblast secretory protein ; Fsp; Gro 1; Gro A; Gro; GRO protein; alpha; GRO-alpha(1-73); GRO-alpha(6-73); Gro1; GRO1 oncogene (melanoma growth stimulating activity; alpha); GRO1 oncogene (melanoma growth-stimulating activity) ; Gro1 oncogene; GROa; GROA_HUMAN; Growth-regulated alpha protein; KC; KC chemokine; mouse; homolog of; melanoma growth stimulatory activity alpha ; Melanoma growth stimulatory activity; Melanoma growth stimulatory activity; alpha; MGSA alpha ; MGSA; MGSA-a; N51; NAP-3; NAP3; Neutrophil-activating protein 3; Platelet-derived growth factor-inducible protein KC; Scyb 1; Scyb1; Secretory protein N51; Small inducible cytokine subfamily B; member 1
Target Background
This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
