Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRPEL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 33-225 of human GRPEL2 (NP_689620.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GRPEL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 33-225 of human GRPEL2 (NP_689620.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11612A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRPEL2 |
| Target Synonyms | Mt-GrpE#2; GRPEL2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, K-562, LO2, MCF7, Mouse brain, Mouse liver, Mouse lung, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 33-225 of human GRPEL2 (NP_689620.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL | Uniprot ID | Q8TAA5 |
Uniprot Id
Q8TAA5
Target Species
Human
Target Name
GRPEL2
Target Full Name
GrpE protein homolog 2, mitochondrial
Target Function
Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Stimulates ATPase activity of mt-HSP70. May also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
GrpE family
Target Synonyms
GrpE like 2; mitochondrial; GrpE protein homolog 2; GRPE2_HUMAN; GRPEL 2; Grpel2; mitochondrial; Mt GrpE#2; Mt-GrpE#2
Target Background
Predicted to enable adenyl-nucleotide exchange factor activity and unfolded protein binding activity. Predicted to be involved in protein import into mitochondrial matrix. Located in mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
