-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GSTM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human GSTM1 (NP_666533.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GSTM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human GSTM1 (NP_666533.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06900A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GSTM1 |
| Target Synonyms | MU; H-B; GST1; GTH4; GTM1; MU-1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GSTM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain, Mouse ovary | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human GSTM1 (NP_666533.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK | Uniprot ID | P09488 |
Uniprot Id
P09488
Target Species
Human
Target Name
GSTM1
Target Full Name
Glutathione S-transferase Mu 1
Target Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers.
Target Subcellular Location
Cytoplasm.
Target Protein Families
GST superfamily, Mu family
Target Tissue Specificity
Liver (at protein level).
Target Synonyms
EC=2.5.1.18; Glutathione S-transferase Mu 1; GST class-mu 1; GST HB subunit 4; GST1; Gstm1; GSTM1-1; GSTM1_HUMAN; GSTM1a-1a; GSTM1b-1b; GTH4; GTM1; H-B; LIVER AND FIBROBLAST GST1; MU; MU-1
Target Background
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene.
Notification