-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GSTM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-225 of human GSTM3 (NP_000840.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GSTM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-225 of human GSTM3 (NP_000840.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02378A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GSTM3 |
| Target Synonyms | GST5; GSTB; GTM3; GSTM3-3; GSTM3TV2; hGSTM3-3; GSTM3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Mouse liver, Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 101-225 of human GSTM3 (NP_000840.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC | Uniprot ID | P21266 |
Uniprot Id
P21266
Target Species
Human
Target Name
GSTM3
Target Full Name
Glutathione S-transferase Mu 3
Target Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May govern uptake and detoxification of both endogenous compounds and xenobiotics at the testis and brain blood barriers.
Target Subcellular Location
Cytoplasm.
Target Protein Families
GST superfamily, Mu family
Target Tissue Specificity
Testis and brain.
Target Research Area
Metabolism
Target Synonyms
brain GST; brain type mu glutathione S transferase; glutathione S alkyltransferase M3 ; glutathione S aryltransferase M3; glutathione S transferase M3 (brain); glutathione S transferase M3; Glutathione S transferase Mu 3 ; glutathione S transferase, Mu 3 ; Glutathione S-transferase Mu 3; GST class mu 3; GST class-mu 3; GST5; GSTB; Gstm3; GSTM3-3; GSTM3_HUMAN; GTM3; hGSTM3-3; MGC3310; MGC3704; S (hydroxyalkyl)glutathione lyase M3
Target Background
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins. Alternative splicing results in multiple transcript variants.
Notification