-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GSTM5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human GSTM5 (NP_000842.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GSTM5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human GSTM5 (NP_000842.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04909A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GSTM5 |
| Target Synonyms | GTM5; GSTM5-5; GSTM5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat brain, Mouse liver, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human GSTM5 (NP_000842.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK | Uniprot ID | P46439 |
Uniprot Id
P46439
Target Species
Human
Target Name
GSTM5
Target Full Name
Glutathione S-transferase Mu 5
Target Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Target Subcellular Location
Cytoplasm.
Target Protein Families
GST superfamily, Mu family
Target Synonyms
Glutathione S alkyltransferase M5; Glutathione S aralkyltransferase M5; Glutathione S aryltransferase M5; Glutathione S transferase M5; Glutathione S transferase Mu 5; Glutathione S-transferase Mu 5; GST class mu 5; GST class-mu 5; GSTM 5; GSTM5 5; Gstm5; GSTM5-5; GSTM5_HUMAN; GTM 5; GTM5; OTTHUMP00000013359; OTTHUMP00000013361; S (hydroxyalkyl)glutathione lyase M5
Target Background
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds.
Notification