Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GUCA2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GUCA2B (NP_009033.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GUCA2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GUCA2B (NP_009033.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09042A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GUCA2B |
| Target Synonyms | UGN; GCAP-II; GUCA2B | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse intestine | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GUCA2B (NP_009033.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDC | Uniprot ID | Q16661 |
Uniprot Id
Q16661
Target Species
Human
Target Name
GUCA2B
Target Full Name
Guanylate cyclase activator 2B
Target Function
Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
Target Subcellular Location
Secreted.
Target Protein Families
Guanylin family
Target Tissue Specificity
Stomach and intestine.
Target Research Area
Signal Transduction
Target Synonyms
GUCA2B; GCAP II; GCAP-II; Guanylate cyclase activator 2B (uroguanylin); Guanylate cyclase activator 2B; Guanylate cyclase C-activating peptide II; GUC2B_HUMAN; GUCA2B; UGN; Uroguanylin
Target Background
This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this peptide to its cognate receptor stimulates an increase in cyclic GMP and may regulate salt and water homeostasis in the intestine and kidneys.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
