Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GYS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 594-703 of human GYS2 (NP_068776.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GYS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 594-703 of human GYS2 (NP_068776.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03376A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GYS2 |
| Target Synonyms | GYS2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 594-703 of human GYS2 (NP_068776.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLLDWRYLGRYYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN | Uniprot ID | P54840 |
Uniprot Id
P54840
Target Species
Human
Target Name
GYS2
Target Full Name
Glycogen [starch] synthase, liver
Target Function
Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
Target Involvement
Glycogen storage disease 0 (GSD0)
Target Protein Families
Glycosyltransferase 3 family
Target Synonyms
EC 2.4.1.11; Glycogen [starch] synthase; Glycogen starch synthase liver; Glycogen synthase 2 liver; Gys2; GYS2_HUMAN; liver
Target Background
The protein encoded by this gene, liver glycogen synthase, catalyzes the rate-limiting step in the synthesis of glycogen - the transfer of a glucose molecule from UDP-glucose to a terminal branch of the glycogen molecule. Mutations in this gene cause glycogen storage disease type 0 (GSD-0) - a rare type of early childhood fasting hypoglycemia with decreased liver glycogen content.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
