Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HAPLN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-354 of human HAPLN1 (P10915) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HAPLN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-354 of human HAPLN1 (P10915) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13909A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HAPLN1 |
| Target Synonyms | CRT1; CRTL1; HAPLN1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A549, Mouse brain, Mouse lung, SH-SY5Y, U-2 OS | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-354 of human HAPLN1 (P10915). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN | Uniprot ID | P10915 |
Uniprot Id
P10915
Target Species
Human
Target Name
HAPLN1
Target Full Name
Hyaluronan and proteoglycan link protein 1
Target Function
Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
HAPLN family
Target Tissue Specificity
Widely expressed. Weakly expressed in the brain.
Target Research Area
Signal Transduction
Target Synonyms
Cartilage link protein ; cartilage linking protein 1 ; Cartilage-link protein; Cartilage-linking protein 1; CLP; CRTL1 ; Crtl1l; HAPLN1; HPLN1_HUMAN; Hyaluronan and proteoglycan link protein 1; Hyaluronan and proteoglycan link protein 1 precursor ; LP; Proteoglycan link protein
Target Background
Predicted to enable hyaluronic acid binding activity. Predicted to be an extracellular matrix structural constituent conferring compression resistance. Predicted to be involved in central nervous system development and skeletal system development. Colocalizes with collagen-containing extracellular matrix.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
