-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Haptoglobin (HP) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 307-406 of human Haptoglobin (HP) (P00738) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Haptoglobin (HP) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 307-406 of human Haptoglobin (HP) (P00738) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13922A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Haptoglobin (HP) |
| Target Synonyms | BP; HPA1S; HP2ALPHA2; Haptoglobin (HP) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma, Mouse liver, Rat liver, Rat plasma | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 307-406 of human Haptoglobin (HP) (P00738). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN | Uniprot ID | P00738 |
Uniprot Id
P00738
Target Species
Human
Target Name
HP
Target Full Name
Haptoglobin
Target Function
As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity, and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidly cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.; The uncleaved form of allele alpha-2 (2-2), known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens.
Target Involvement
Anhaptoglobinemia (AHP)
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase S1 family
Target Tissue Specificity
Expressed by the liver and secreted in plasma.
Target Research Area
Immunology, Cardiovascular
Target Synonyms
Binding peptide; BP; Haptoglobin alpha chain; Haptoglobin alpha(1S) beta; Haptoglobin alpha(2FS) beta; Haptoglobin beta chain; Haptoglobin, alpha polypeptide; Haptoglobin, beta polypeptide; HP; HP2 ALPHA2; HP2ALPHA2; HPA1S; HPT; HPT_HUMAN; MGC111141; Zonulin
Target Background
This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin, which allows degradative enzymes to gain access to the hemoglobin, while at the same time preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin. Mutations in this gene and/or its regulatory regions cause ahaptoglobinemia or hypohaptoglobinemia. This gene has also been linked to diabetic nephropathy, the incidence of coronary artery disease in type 1 diabetes, Crohn's disease, inflammatory disease behavior, primary sclerosing cholangitis, susceptibility to idiopathic Parkinson's disease, and a reduced incidence of Plasmodium falciparum malaria. The protein encoded also exhibits antimicrobial activity against bacteria. A similar duplicated gene is located next to this gene on chromosome 16. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification