-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HARS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HARS (NP_002100.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HARS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HARS (NP_002100.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01882A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HARS |
| Target Synonyms | HRS; HARS; CMT2W; USH3B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, NCI-H460, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HARS (NP_002100.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAG | Uniprot ID | P12081 |
Uniprot Id
P12081
Target Species
Human
Target Name
HARS1
Target Full Name
Histidine--tRNA ligase, cytoplasmic
Target Function
Catalyzes the ATP-dependent ligation of histidine to the 3'-end of its cognate tRNA, via the formation of an aminoacyl-adenylate intermediate (His-AMP). Plays a role in axon guidance.
Target Involvement
Usher syndrome 3B (USH3B); Charcot-Marie-Tooth disease 2W (CMT2W)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Class-II aminoacyl-tRNA synthetase family
Target Tissue Specificity
Brain, heart, liver and kidney.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
cytoplasmic; EC 6.1.1.21 ; FLJ20491 ; HARS; HisRS; Histidine tRNA ligase, cytoplasmic; histidine translase; Histidine tRNA ligase; Histidine--tRNA ligase; Histidyl tRNA synthetase ; Histidyl-tRNA synthetase; HRS ; Human histidyl tRNA synthetase homolog (HO3) mRNA complete cds; SYHC_HUMAN; USH3B
Target Background
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a cytoplasmic enzyme which belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. The gene is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis. Several transcript variants encoding different isoforms have been found for this gene.
Notification