Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HAUS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-250 of human HAUS1 (NP_612452.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HAUS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-250 of human HAUS1 (NP_612452.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09224A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HAUS1 |
| Target Synonyms | HEIC; CCDC5; HEI-C; HsT1461; HAUS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BxPC-3, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-250 of human HAUS1 (NP_612452.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NDLTSDLFRTKSKSEEIKIELEKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSL | Uniprot ID | Q96CS2 |
Uniprot Id
Q96CS2
Target Species
Human
Target Name
HAUS1
Target Full Name
HAUS augmin-like complex subunit 1
Target Function
Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Cytoplasm, cytoskeleton, spindle pole.
Target Protein Families
HAUS1 family
Target Tissue Specificity
Widely expressed. Expressed in pancreas, kidney, skeletal muscle, liver and heart. Weakly expressed in lung, brain and placenta.
Target Synonyms
Coiled coil domain containing 5 (spindle associated) ; Coiled coil domain containing protein 5; Coiled-coil domain-containing protein 5; Enhancer of invasion cluster; Enhancer of invasion-cluster; HAUS augmin-like complex subunit 1; HAUS1; HAUS1_HUMAN; HEI-C; HEIC; HsT1461
Target Background
HAUS1 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare, ' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
